RetrogeneDB ID: | retro_pabe_2786 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 5:143578226..143578534(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPL11 | ||
Ensembl ID: | ENSPPYG00000003025 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein L11 [Source:HGNC Symbol;Acc:14042] |
Percent Identity: | 86.54 % |
Parental protein coverage: | 53.12 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MSKLGRATRGLRKPEVGGVIRAIVRAGLAM-PGPP-LGPALGQRGVSINQFCKEFNEKTKDIKEGIPLPT |
MSKLGRAT.GLRKPEVGGVI..IVRAGLAM.PGPP.LGP.LGQR..SINQFCKEFN..TKDIKEGIPL.T | |
Retrocopy | MSKLGRATGGLRKPEVGGVIQTIVRAGLAM>PGPP>LGPVLGQRRASINQFCKEFNARTKDIKEGIPLLT |
Parental | KILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGAR |
KI.VKPD.TFEIKIGQPTVSYF.KAAAGIEKGAR | |
Retrocopy | KIFVKPDGTFEIKIGQPTVSYFVKAAAGIEKGAR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .15 RPM |
SRP007412_cerebellum | 0 .00 RPM | 18 .12 RPM |
SRP007412_heart | 0 .00 RPM | 14 .42 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .52 RPM |
SRP007412_liver | 0 .00 RPM | 18 .27 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3390 |
Pan troglodytes | retro_ptro_2305 |
Gorilla gorilla | retro_ggor_2296 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000012706 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001470 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004111 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015216 | 2 retrocopies | |
Homo sapiens | ENSG00000174547 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001300 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004047 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024902 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006111 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010448 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000003025 | 1 retrocopy |
retro_pabe_2786 ,
|
Pan troglodytes | ENSPTRG00000003924 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000025971 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000008712 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000002678 | 1 retrocopy |