RetrogeneDB ID: | retro_pabe_3796 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:95786962..95787287(-) | ||
Located in intron of: | ENSPPYG00000020532 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFB5 | ||
Ensembl ID: | ENSPPYG00000014493 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [Source:HGNC Symbol;Acc:7700] |
Percent Identity: | 68.81 % |
Parental protein coverage: | 73.47 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | PVRHSGAH-GKRLFFIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYIPEHWE |
PV.HSG.H.GKRLF...PS.FY...F..LL.FYI...GIPVAI..TLVNVFIG..EL.EIPEGYIPE.WE | |
Retrocopy | PV*HSGDH>GKRLFIMKPSGFYNGCFFNLLKFYILFIGIPVAIGETLVNVFIGETELVEIPEGYIPEQWE |
Parental | YYKHPISRWIARNFYDSPEKIYERTMAVLQIEAETAELR |
YYKHPI.RWI...FYD.PE..YERTMA.LQ.E.E.AEL. | |
Retrocopy | YYKHPILRWIVHTFYDEPENNYERTMAILQMETEKAELQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .06 RPM |
SRP007412_cerebellum | 0 .00 RPM | 10 .46 RPM |
SRP007412_heart | 0 .00 RPM | 25 .29 RPM |
SRP007412_kidney | 0 .00 RPM | 17 .60 RPM |
SRP007412_liver | 0 .00 RPM | 11 .69 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4879 |
Pan troglodytes | retro_ptro_3252 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000002684 | 1 retrocopy | |
Equus caballus | ENSECAG00000000682 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019363 | 1 retrocopy | |
Homo sapiens | ENSG00000136521 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000014166 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000999 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009746 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000021300 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005842 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000014493 | 2 retrocopies |
retro_pabe_3018, retro_pabe_3796 ,
|
Pan troglodytes | ENSPTRG00000015649 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000004286 | 1 retrocopy | |
Sorex araneus | ENSSARG00000006918 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011764 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010557 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000008910 | 3 retrocopies |