RetrogeneDB ID: | retro_pabe_693 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 11:51682175..51682592(+) | ||
Located in intron of: | ENSPPYG00000003436 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | WBP2 | ||
Ensembl ID: | ENSPPYG00000008640 | ||
Aliases: | None | ||
Description: | WW domain binding protein 2 [Source:HGNC Symbol;Acc:12738] |
Percent Identity: | 61.49 % |
Parental protein coverage: | 54.79 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 5 |
Parental | TFTAGGAIEFGQRMLQVASQASRGE-VPSGAYGYSYMPSGAYV-YPPPVANGMYPCPPGYPYPPPPPEFY |
TFTAG...EFGQ..L.VA..ASR....PSGAY..SYMP.GA....P.PVA....P....Y.YPPPPPEFY | |
Retrocopy | TFTAGSITEFGQWVLWVAF*ASRDK<APSGAYRCSYMPGGACA<LPSPVAMECTPALL-YSYPPPPPEFY |
Parental | PGPPMMDGAMGYVQPPPP-PYPGP-MEPPVSGPDVPSTPAAEAKAA-EAAASAYYNPGNPHNVYMPTSQP |
.GPP.MD.AM..VQP....PYPGP..EPP...P..PS.PA..AKA..EAAA.AYYN.GN.HN.YM...QP | |
Retrocopy | LGPPVMDRAMKQVQPHGT>PYPGP<LEPPIRSPKIPSIPA--AKAK<EAAARAYYNLGNSHNIYMHMYQP |
Parental | PPPPYYPP |
PPPPYYPP | |
Retrocopy | PPPPYYPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .17 RPM | 436 .63 RPM |
SRP007412_cerebellum | 0 .00 RPM | 132 .55 RPM |
SRP007412_heart | 0 .06 RPM | 51 .30 RPM |
SRP007412_kidney | 0 .20 RPM | 117 .54 RPM |
SRP007412_liver | 0 .03 RPM | 42 .72 RPM |
Species | RetrogeneDB ID |
---|---|
Macaca mulatta | retro_mmul_1062 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000004946 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000037619 | 1 retrocopy | |
Felis catus | ENSFCAG00000005760 | 1 retrocopy | |
Homo sapiens | ENSG00000132471 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009241 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000000070 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009381 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000007725 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000013775 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001625 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000006045 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008640 | 3 retrocopies |
retro_pabe_693 , retro_pabe_75, retro_pabe_913,
|
Pan troglodytes | ENSPTRG00000009660 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021421 | 2 retrocopies |