RetrogeneDB ID: | retro_pabe_936 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 12:67449864..67450098(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000019565 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.69 % |
| Parental protein coverage: | 53.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AGCRLRDFTEKIMNVKGKVILSMLVVSTVIVVFWEYINSPEASFLWIYHSKNPEVDDSSAQKGWWFLSWF |
| .G....D..EKIMNVKG.VI..MLVVS..IVV.W..IN..E.S.LW.YH.K.PEV.....QKG.WF.S.F | |
| Retrocopy | SGVKEADDKEKIMNVKGNVIPPMLVVSAAIVVVWKCINTQEGSLLWMYHLKHPEVVEGGGQKGRWFPSCF |
| Parental | NNGIHNYQ |
| N.G.HN.Q | |
| Retrocopy | NSGTHNPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .60 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_883 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012094 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009067 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019565 | 1 retrocopy |
retro_pabe_936 ,
|