RetrogeneDB ID: | retro_pcap_214 | ||
Retrocopy location | Organism: | Hyrax (Procavia capensis) | |
| Coordinates: | scaffold_17435:12905..13140(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TOMM7 | ||
| Ensembl ID: | ENSPCAG00000008677 | ||
| Aliases: | None | ||
| Description: | translocase of outer mitochondrial membrane 7 homolog (yeast) [Source:HGNC Symbol;Acc:21648] |
Retrocopy-Parental alignment summary:
>retro_pcap_214
GTAAAGCTGAGTAAAGAGGCCAAGTAAAGGCTACAGCAGCAATTCAAGGGCAGCCAGTTTACCATTCATTGAGACTTCAT
CCCTCTCAGTATTCATCTGGGATTTCTGAGGGGTACAGATCTTGGAATGCCTGAACCAACAGTTTTGAGGCTATTTGGGG
GATGAAGGTCTATTTGGTCATCTGGATTTGAAAGCTATCAGTGGATAAGAAAGTCTTGGAAAGTATATATTCTGG
ORF - retro_pcap_214 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 70.89 % |
| Parental protein coverage: | 96.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | VKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL-YFG-DEGLFGHLDLEAING- |
| VKLSKEAK.RLQQ.FKG.QF.I...FIPL.I.LGF.RG.D.GMPEPTVL..FG.DEGLFGHLDL.AI.G. | |
| Retrocopy | VKLSKEAK*RLQQQFKGSQFTIH*DFIPLSIHLGFLRGTDLGMPEPTVLRLFG>DEGLFGHLDLKAISG* |
| Parental | EGHGRCTFW |
| E..G...FW | |
| Retrocopy | ESLGKYIFW |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Procavia capensis was not studied using RNA-Seq expression data.
Procavia capensis was not studied using ChIP-Seq data.
Procavia capensis was not studied using EST data.
Procavia capensis was not studied using FANTOM5 data.
retro_pcap_214 was not experimentally validated.
Retrocopy orthology:
Procavia capensis does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Procavia capensis | ENSPCAG00000008677 | 1 retrocopy |
retro_pcap_214 ,
|