RetrogeneDB ID: | retro_ptro_1435 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 20:40489935..40490106(-) | ||
Located in intron of: | ENSPTRG00000013507 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM14C | ||
Ensembl ID: | ENSPTRG00000017720 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.95 % |
Parental protein coverage: | 50.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH |
SQDPR..WVFLATS.TLAGIMGMRFYHSGKFM..GL.AG.SLLMVAK.G.S..N.PH | |
Retrocopy | SQDPRDAWVFLATSETLAGIMGMRFYHSGKFMSPGLTAGTSLLMVAKLGISTLNKPH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 29 .92 RPM |
SRP007412_cerebellum | 0 .07 RPM | 20 .00 RPM |
SRP007412_heart | 0 .06 RPM | 30 .28 RPM |
SRP007412_kidney | 0 .05 RPM | 56 .64 RPM |
SRP007412_liver | 0 .03 RPM | 27 .76 RPM |
SRP007412_testis | 0 .00 RPM | 8 .96 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2481 |