RetrogeneDB ID: | retro_ptro_1572 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2A:3129337..3129544(-) | ||
| Located in intron of: | ENSPTRG00000011616 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPTRG00000028317 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 92.75 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | NSVVATAQTRLRSYSRASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| NSVVATAQTRL.S.S.ASLRFSS.TMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKET.EQEKQAGES | |
| Retrocopy | NSVVATAQTRLLSFSHASLRFSSTTMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTEQEKQAGES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 302 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 63 .56 RPM |
| SRP007412_heart | 0 .00 RPM | 53 .28 RPM |
| SRP007412_kidney | 0 .05 RPM | 105 .68 RPM |
| SRP007412_liver | 0 .10 RPM | 82 .39 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038488 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |