RetrogeneDB ID: | retro_ptro_1572 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2A:3129337..3129544(-) | ||
Located in intron of: | ENSPTRG00000011616 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000028317 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 92.75 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | NSVVATAQTRLRSYSRASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
NSVVATAQTRL.S.S.ASLRFSS.TMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKET.EQEKQAGES | |
Retrocopy | NSVVATAQTRLLSFSHASLRFSSTTMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETTEQEKQAGES |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 302 .67 RPM |
SRP007412_cerebellum | 0 .00 RPM | 63 .56 RPM |
SRP007412_heart | 0 .00 RPM | 53 .28 RPM |
SRP007412_kidney | 0 .05 RPM | 105 .68 RPM |
SRP007412_liver | 0 .10 RPM | 82 .39 RPM |
SRP007412_testis | 0 .00 RPM | 8 .01 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000038488 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000006450 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014256 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000028317 | 4 retrocopies |