RetrogeneDB ID: | retro_ptro_1823 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:131952828..131953179(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMED10 | ||
Ensembl ID: | ENSPTRG00000006552 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 79.49 % |
Parental protein coverage: | 53.42 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LALLLLFLLGPSLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILY |
LA.L.LFL..PSLVL.ISFHLPINS.K.L.EEIHKDLLV.GAYEIS..SGGAG.L..HLK.TDSAGHILY | |
Retrocopy | LAWLFLFLPSPSLVLTISFHLPINS*KFLHEEIHKDLLVMGAYEISNKSGGAGSLHNHLKVTDSAGHILY |
Parental | SKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEA |
SKEDATKGKFAF..ED.DMFEV.FESK..G.IPD..VILDMKHGVEA | |
Retrocopy | SKEDATKGKFAFMLEDDDMFEV*FESKEIGWIPDRFVILDMKHGVEA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 37 .16 RPM |
SRP007412_cerebellum | 0 .04 RPM | 39 .86 RPM |
SRP007412_heart | 0 .06 RPM | 55 .41 RPM |
SRP007412_kidney | 0 .03 RPM | 109 .60 RPM |
SRP007412_liver | 0 .00 RPM | 89 .89 RPM |
SRP007412_testis | 0 .00 RPM | 88 .10 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2701 |
Macaca mulatta | retro_mmul_885 |
Callithrix jacchus | retro_cjac_1409 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000016899 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020627 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000019851 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010607 | 1 retrocopy | |
Homo sapiens | ENSG00000170348 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007453 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000017125 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000015168 | 2 retrocopies | |
Mus musculus | ENSMUSG00000021248 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016453 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000004669 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029389 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006552 | 2 retrocopies |
retro_ptro_1823 , retro_ptro_2724,
|
Rattus norvegicus | ENSRNOG00000007901 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000007392 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000003089 | 1 retrocopy |