RetrogeneDB ID: | retro_ptro_2655 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:132130082..132130410(-) | ||
Located in intron of: | ENSPTRG00000022792 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000005534 | ||
Aliases: | None | ||
Description: | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Source:UniProtKB/TrEMBL;Acc:H2Q711] |
Percent Identity: | 76.79 % |
Parental protein coverage: | 81.48 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | QGSGRITAAVIEHLERLALVDFGSREAVTRLEKAIAFADRLRAVDTDG-VEPMESVLEDRCLYLRSDNVV |
QGSG.I...VIE.LE.L..VDFGS.EAV.RLEK.I.FA..L...DTDG.VEPMESVLE.RCLYLRS.NVV | |
Retrocopy | QGSGQIMIEVIEPLEPLVPVDFGSLEAVVRLEKDIIFAHGLHPMDTDG<VEPMESVLEGRCLYLRSNNVV |
Parental | EGNCADELLQNSHRVVEEYFVAP-PGNISLPKLDEQEPFPHS |
.GNCA.ELLQNSH.VV.EYFVAP.PGNISLPKLDEQEPF.HS | |
Retrocopy | GGNCAEELLQNSHCVVKEYFVAP<PGNISLPKLDEQEPFSHS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 15 .30 RPM |
SRP007412_cerebellum | 0 .07 RPM | 25 .95 RPM |
SRP007412_heart | 0 .00 RPM | 6 .85 RPM |
SRP007412_kidney | 0 .08 RPM | 21 .60 RPM |
SRP007412_liver | 0 .03 RPM | 13 .75 RPM |
SRP007412_testis | 0 .00 RPM | 8 .01 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3902 |
Pongo abelii | retro_pabe_3181 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
Felis catus | ENSFCAG00000024015 | 1 retrocopy | |
Homo sapiens | ENSG00000257218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy |
retro_ptro_2655 ,
|
Sus scrofa | ENSSSCG00000009907 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |