RetrogeneDB ID: | retro_ptro_2771 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 8:83098540..83098850(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | IGJ | ||
Ensembl ID: | ENSPTRG00000016134 | ||
Aliases: | None | ||
Description: | immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides [Source:HGNC Symbol;Acc:5713] |
Percent Identity: | 68.27 % |
Parental protein coverage: | 64.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MKNHLLFWGVLAIFIKAVHVKA-QEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNR |
.KN.LLFW.V.AIF.KAV.V....EDERI.LVD.K.K.A.....II.S..DPNE.IVERNI.I.V.L.N. | |
Retrocopy | IKNYLLFWTVQAIFVKAVLVTP>DEDERIILVDDKYKWAQVIFTIISSTKDPNEGIVERNIQIAVLLDNK |
Parental | ENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDN |
.NISDP.S.LRT.FVYHLS.LCKKCDPTEVELDN | |
Retrocopy | KNISDPISRLRTKFVYHLSYLCKKCDPTEVELDN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .16 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .11 RPM |
SRP007412_heart | 0 .00 RPM | 12 .45 RPM |
SRP007412_kidney | 0 .00 RPM | 49 .69 RPM |
SRP007412_liver | 0 .00 RPM | 5 .70 RPM |
SRP007412_testis | 0 .00 RPM | 0 .84 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4086 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000014618 | 1 retrocopy | |
Homo sapiens | ENSG00000132465 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022096 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007714 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014809 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016134 | 1 retrocopy |
retro_ptro_2771 ,
|