RetrogeneDB ID: | retro_pvam_337 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | GeneScaffold_2633:457043..457259(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C2orf76 | ||
Ensembl ID: | ENSPVAG00000011615 | ||
Aliases: | None | ||
Description: | chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017] |
Percent Identity: | 80.56 % |
Parental protein coverage: | 58.06 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | PFRNYKYDKLKIIHQAHKSKTNELVLSLEDDDRLLLKEDSTLKAAGIANETEIAFFCEEDYKNYKANPIS |
PFRNYKYDKLK..HQA.KSKTNELVLSL.D.DR.LLK.DSTLKAA.I.NE.EIA...EE.YKNYKANPIS | |
Retrocopy | PFRNYKYDKLKVVHQAYKSKTNELVLSLKDADRILLKKDSTLKAARITNENEIALLYEEEYKNYKANPIS |
Parental | SW |
SW | |
Retrocopy | SW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000008507 | 2 retrocopies | |
Bos taurus | ENSBTAG00000010599 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004896 | 2 retrocopies | |
Equus caballus | ENSECAG00000002063 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004031 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000000943 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026388 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011615 | 1 retrocopy |
retro_pvam_337 ,
|
Sus scrofa | ENSSSCG00000015718 | 1 retrocopy |