RetrogeneDB ID: | retro_pvam_601 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | GeneScaffold_3994:138389..138608(-) | ||
| Located in intron of: | ENSPVAG00000005018 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CSTA | ||
| Ensembl ID: | ENSPVAG00000012705 | ||
| Aliases: | None | ||
| Description: | cystatin A (stefin A) [Source:HGNC Symbol;Acc:2481] |
| Percent Identity: | 80.82 % |
| Parental protein coverage: | 74.49 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MMPGGLTEAKPATPEIQEIANEVKPQLEEKTNETYEEFEVVEYKTQVVAGTNYYLKVRVGHNNYIHLKIF |
| MMPGGL.EAKPAT.EI.EIANEVK..LE.KTNET.EEFE.VEYKTQVVAG.NYY.KVRVGHN.YI..K.F | |
| Retrocopy | MMPGGLIEAKPATLEIKEIANEVKS*LEGKTNET*EEFEAVEYKTQVVAGKNYYIKVRVGHNIYIYPKTF |
| Parental | KAL |
| KAL | |
| Retrocopy | KAL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015604 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034362 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000007022 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012705 | 3 retrocopies |
retro_pvam_230, retro_pvam_601 , retro_pvam_624,
|