RetrogeneDB ID: | retro_rnor_1037 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 14:17389908..17390096(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lamtor2 | ||
Ensembl ID: | ENSRNOG00000019908 | ||
Aliases: | Lamtor2, Mapbpip, RGD1562501, Robld3 | ||
Description: | mitogen-activated protein-binding protein-interacting protein [Source:RefSeq peptide;Acc:NP_001099911] |
Percent Identity: | 81.82 % |
Parental protein coverage: | 51.2 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | QAFNEDSLKFILMDCMEGRVAITRVAN-LL-LCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
QAFNEDSLKFILMDC.E.RVAITRVAN.LL....Y.KETVGFGML.AK..ALVQYLEEPLT.VAAS | |
Retrocopy | QAFNEDSLKFILMDCTEDRVAITRVANFLL<MYVYPKETVGFGMLQAK--ALVQYLEEPLTRVAAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 24 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 27 .08 RPM |
SRP017611_liver | 0 .07 RPM | 20 .31 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000009193 | 1 retrocopy | |
Felis catus | ENSFCAG00000028596 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000023871 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028062 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016953 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000010328 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019908 | 3 retrocopies |
retro_rnor_1037 , retro_rnor_2493, retro_rnor_847,
|
Tursiops truncatus | ENSTTRG00000013344 | 1 retrocopy |