RetrogeneDB ID: | retro_rnor_144 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 10:29152407..29152644(-) | ||
| Located in intron of: | ENSRNOG00000003936 | ||
Retrocopy information | Ensembl ID: | ENSRNOG00000048034 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ppp1r14a | ||
| Ensembl ID: | ENSRNOG00000020676 | ||
| Aliases: | Ppp1r14a, Cpi17 | ||
| Description: | Protein phosphatase 1 regulatory subunit 14A [Source:UniProtKB/Swiss-Prot;Acc:Q99MC0] |
Retrocopy-Parental alignment summary:
>retro_rnor_144
GAGTCAGATATGCCAAATGAAGTCAATATTGATGATGAACTGTTGGAATTGGACAGTCAAGAGGAAAGAAGATGCAAAAT
CCAGGGGCTCTTGGAGTACTACACAAATCCAACAGAGGGCATCATCCAGGAGCTGCTGGCCAAGCTGCACGGCATGCATA
AGCAACCACAGCCCAGCCAATCAGATGACTATAGCCCAAGTCCCTGCCAGGACTGGACACACACTGCCCCACCCTGA
ORF - retro_rnor_144 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 70.37 % |
| Parental protein coverage: | 54.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | EADMPDEVNI-DELLELDSEEERCRKIRGLLEACLNPTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLS |
| E.DMP.EVNI.DELLELDS.EER..KI.GLLE...NPTE...QELLAKL.G.HKQP...QPS.SDD.S.S | |
| Retrocopy | ESDMPNEVNIDDELLELDSQEERRCKIQGLLEYYTNPTEGIIQELLAKLHGMHKQP---QPSQSDDYSPS |
| Parental | PRQDPAHTAPP |
| P.QD..HTAPP | |
| Retrocopy | PCQDWTHTAPP |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 2 .72 RPM |
| SRP017611_liver | 0 .20 RPM | 4 .98 RPM |
Rattus norvegicus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_rnor_144 retrocopy.
Rattus norvegicus was not studied using FANTOM5 data.
retro_rnor_144 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_rnor_144 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 3 parental genes, and 4 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000023472 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020676 | 1 retrocopy |
retro_rnor_144 ,
|
| Rattus norvegicus | ENSRNOG00000021151 | 2 retrocopies |