RetrogeneDB ID: | retro_rnor_696 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 10:60569499..60569730(+) | ||
Located in intron of: | ENSRNOG00000029537 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cdc42se2 | ||
Ensembl ID: | ENSRNOG00000042449 | ||
Aliases: | Cdc42se2, RGD1563924 | ||
Description: | CDC42 small effector protein 2 [Source:UniProtKB/Swiss-Prot;Acc:A1L1K4] |
Percent Identity: | 74.03 % |
Parental protein coverage: | 91.67 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGM |
MS.FWLC.NCCIAE..Q.KR....D.SM..E.TNFVH.AH.GSGDLFSG.NSVSSIQNQMQSK.GYG.GM | |
Retrocopy | MSTFWLCLNCCIAEKLQSKRQQ*VD*SMVEELTNFVHIAHIGSGDLFSGTNSVSSIQNQMQSKRGYGSGM |
Parental | PANVQMQ |
PA.VQ.Q | |
Retrocopy | PADVQTQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 91 .45 RPM |
SRP017611_kidney | 0 .00 RPM | 38 .31 RPM |
SRP017611_liver | 0 .00 RPM | 8 .14 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000008774 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000005142 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042449 | 2 retrocopies |
retro_rnor_461, retro_rnor_696 ,
|