RetrogeneDB ID: | retro_shar_812 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL865182.1:199794..200002(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSHAG00000000550 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.75 % |
Parental protein coverage: | 52.55 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | GTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLP-GNFLIAGSWANDVRCWEVQDNGQTIPKAQ |
GTS.FG...T....PMKDIEVT.S.D..IGCL.FS.P.LP.G.F.I..SW.ND.RCWEV.DNGQTIPK.Q | |
Retrocopy | GTSGFGNSGTSK--PMKDIEVTASSDNGIGCLYFSLPILP>GTF-ITESWVNDIRCWEVHDNGQTIPKIQ |
Parental | QMH |
Q.H | |
Retrocopy | QTH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Oryctolagus cuniculus | ENSOCUG00000001585 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000014649 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000000228 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000000550 | 1 retrocopy |
retro_shar_812 ,
|
Sarcophilus harrisii | ENSSHAG00000002438 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000010372 | 1 retrocopy |