RetrogeneDB ID: | retro_sscr_977 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 8:107029723..107030160(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSSSCG00000003849 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 76.87 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEIT |
| .ESDFYL.Y.VGHKGKF.HEFL.FEF.PDGKLRYANN.NYKNDVM.RKEA..HKSVMEELKRIIDDSEIT | |
| Retrocopy | VESDFYLCYHVGHKGKFSHEFLYFEF*PDGKLRYANNGNYKNDVMSRKEACIHKSVMEELKRIIDDSEIT |
| Parental | KEDDALWPPPDRVGRQELEIVIGDEHISFTT-SKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGL |
| KED..L.PPPD..G.QELEI.I..E..S.TT..KIGSLIDVNQ.KDPEGL.VF.YL.Q.LKCL.FSL.GL | |
| Retrocopy | KEDGTLRPPPDQGG*QELEIIIAEEYTSLTT<TKIGSLIDVNQFKDPEGLQVFDYLLQELKCLIFSLTGL |
| Parental | HFKIKPI |
| ..KIK.I | |
| Retrocopy | YLKIKSI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 13 .01 RPM |
| SRP014902_testis | 0 .00 RPM | 17 .82 RPM |
| SRP018288_heart | 0 .00 RPM | 13 .62 RPM |
| SRP018288_kidney | 0 .00 RPM | 20 .98 RPM |
| SRP018288_liver | 0 .00 RPM | 9 .91 RPM |
| SRP018288_lung | 0 .00 RPM | 42 .87 RPM |
| SRP018856_adipose | 0 .00 RPM | 18 .17 RPM |
| SRP035408_brain | 0 .00 RPM | 28 .55 RPM |
| SRP035408_liver | 0 .00 RPM | 32 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009587 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000015908 | 6 retrocopies | |
| Felis catus | ENSFCAG00000025232 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012081 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000635 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000003849 | 3 retrocopies |
retro_sscr_1007, retro_sscr_706, retro_sscr_977 ,
|