RetrogeneDB ID: | retro_tsyr_1844 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_61788:10948..11163(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM167A | ||
Ensembl ID: | ENSTSYG00000010018 | ||
Aliases: | None | ||
Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
Percent Identity: | 80.82 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSVLDRNKTGLL-GIFWKCARIGERKSPYVAVCCVVMAFSVL |
.SAIFNF.SLLTVIL.L.CTCA.I.SLAPS.LDRN.TGLL.GIFWKCARIG..KSPYV.VCCVVMAF..L | |
Retrocopy | ISAIFNF*SLLTVILMLLCTCANIHSLAPSLLDRNTTGLL<GIFWKCARIG*QKSPYVGVCCVVMAFGIL |
Parental | FIQ |
FIQ | |
Retrocopy | FIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |