RetrogeneDB ID: | retro_tsyr_70 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | GeneScaffold_1634:10476..10710(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FXYD4 | ||
Ensembl ID: | ENSTSYG00000014460 | ||
Aliases: | None | ||
Description: | FXYD domain containing ion transport regulator 4 [Source:HGNC Symbol;Acc:4028] |
Percent Identity: | 72.5 % |
Parental protein coverage: | 97.56 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RVTSALLLLAGLPTLDANDSFADKDNPFYYDWEGLQLSGMIVGGLLCIAGIAVALSGKCKCKGNQKHSPL |
RVTS.LLLLA.LP..D..D.FADKD..F.YDWEGL.LS...V...LCIAGIAV.LSG.CK.KG.QKHSPL | |
Retrocopy | RVTSVLLLLAELPGSDTHDPFADKDSIFCYDWEGL*LSSRVV--VLCIAGIAVTLSGRCKYKGIQKHSPL |
Parental | PEKATPLITP |
PEKATPL.TP | |
Retrocopy | PEKATPLLTP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000024923 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017385 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000010030 | 4 retrocopies | |
Felis catus | ENSFCAG00000022417 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000027578 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000006722 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000016033 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014460 | 3 retrocopies |
retro_tsyr_1494, retro_tsyr_70 , retro_tsyr_875,
|