RetrogeneDB ID: | retro_ttru_1165 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_106116:209106..209457(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NOL12 | ||
| Ensembl ID: | ENSTTRG00000004799 | ||
| Aliases: | None | ||
| Description: | nucleolar protein 12 [Source:HGNC Symbol;Acc:28585] |
| Percent Identity: | 50.41 % |
| Parental protein coverage: | 55.88 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 5 |
| Parental | EEIKKRLKEEQKKLREERHREYLKMLAEREEA----LEEAD-ELDRLVTAKTEPVQYDHL-NHTVTVTTI |
| EE....L....K..RE............R.EA....LE.AD..LD.LVTAKTE..QY.H..N.T.T.TT. | |
| Retrocopy | EERRVYLPGFPKPKRERKTAALEEVKQRRREALSGPLEDAD<QLDQLVTAKTESLQYKHP<NYTATATTM |
| Parental | -SNLDFSAARLLGL-PPPEQGVGHRSEEGASSAEKPTRALCRKSRDP-LLSQR |
| .S.LDF...RLL.L..PPEQ..GH.S.E.ASS...P..AL.RKSRDP.LL.QR | |
| Retrocopy | >SYLDFLGVRLL*L<VPPEQRAGHGSGEAASSM*NPS*ALPRKSRDP<LLYQR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010139 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012487 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011050 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004273 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017013 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008255 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000010097 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000009745 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004799 | 1 retrocopy |
retro_ttru_1165 ,
|