RetrogeneDB ID: | retro_ttru_1697 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_86323:156388..156622(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COMMD6 | ||
Ensembl ID: | ENSTTRG00000003379 | ||
Aliases: | None | ||
Description: | COMM domain containing 6 [Source:HGNC Symbol;Acc:24015] |
Percent Identity: | 93.59 % |
Parental protein coverage: | 63.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ALMEGCSEPQLDAKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF |
A.MEGCSEPQL.AKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF | |
Retrocopy | AAMEGCSEPQLEAKAKVTNQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVKNKSFEMTIPQF |
Parental | QNFYRQFK |
QNFY...K | |
Retrocopy | QNFYSSRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000011048 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000006061 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000010697 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000970 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026952 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000038012 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003379 | 2 retrocopies |
retro_ttru_1697 , retro_ttru_908,
|