RetrogeneDB ID: | retro_ttru_1871 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_96399:354..592(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL30 | ||
Ensembl ID: | ENSTTRG00000016058 | ||
Aliases: | None | ||
Description: | ribosomal protein L30 [Source:HGNC Symbol;Acc:10333] |
Percent Identity: | 76.25 % |
Parental protein coverage: | 68.7 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MIRHGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTAC-GKYYRVCTLAIIDPGDSDII |
M...GK.KLVIL.NNC...RKSEIEYY.MLAKTGVHHYSGNN.E.GT.C.GK.YRVCTL.IID.GDSDII | |
Retrocopy | MVKQGKVKLVILTNNCHTFRKSEIEYYTMLAKTGVHHYSGNNTEWGTGC>GKNYRVCTLGIIDLGDSDII |
Parental | RSMPEQTGEK |
RSM.EQT..K | |
Retrocopy | RSMSEQTSKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000016047 | 2 retrocopies | |
Ailuropoda melanoleuca | ENSAMEG00000000605 | 18 retrocopies | |
Bos taurus | ENSBTAG00000016278 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015549 | 4 retrocopies | |
Felis catus | ENSFCAG00000002165 | 9 retrocopies | |
Loxodonta africana | ENSLAFG00000002077 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000004620 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000020073 | 12 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017386 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000016058 | 5 retrocopies |