RetrogeneDB ID: | retro_ttru_530 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | GeneScaffold_2604:42119..42307(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NPM2 | ||
Ensembl ID: | ENSTTRG00000008050 | ||
Aliases: | None | ||
Description: | nucleophosmin/nucleoplasmin 2 [Source:HGNC Symbol;Acc:7930] |
Percent Identity: | 61.76 % |
Parental protein coverage: | 51.94 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | DEDTDVSLEKETPVKQVKRLAPQKHTSIAKKKKVEKEE-VAVRYHPKDRSPVGKAKTTPRPKKPGFKK |
..D.DVSLE.ETPVKQVKRL.PQK.T.I....KVEKEE..AVR...KD.SPV..AK....P.K.G.KK | |
Retrocopy | NDDVDVSLEEETPVKQVKRLVPQKQTNITEEEKVEKEE<EAVRTSLKDKSPVRRAK----PEKLGSKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Monodelphis domestica | ENSMODG00000009677 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000008050 | 1 retrocopy |
retro_ttru_530 ,
|