RetrogeneDB ID: | retro_btau_769 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 19:50678400..50678660(+) | ||
Located in intron of: | ENSBTAG00000003687 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BT.43863 | ||
Ensembl ID: | ENSBTAG00000021491 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P25712] |
Percent Identity: | 64.77 % |
Parental protein coverage: | 78.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAASLLLRQGRAGALKTVLLEAGVFRGVAPAVSLSAESGKNEKGLPPNPKKQS-PPKKPVSAAPTEPFDN |
M..S.LL.Q.RAG.LKTVLLEAGVFRG..P..SLS.ESGKNEK.LPPNPKKQS.P.......A..E.... | |
Retrocopy | MVTSFLLWQRRAGVLKTVLLEAGVFRGLTPTISLSTESGKNEKELPPNPKKQSPPKEHTPATASAEGSEK |
Parental | -TTYKNLQHHDYSTYTFL |
..T.KNLQH.DY.TYTFL | |
Retrocopy | <STFKNLQHQDYGTYTFL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 11 .32 RPM |
ERP005899_muscle | 0 .00 RPM | 43 .34 RPM |
SRP017611_brain | 0 .00 RPM | 41 .66 RPM |
SRP017611_kidney | 0 .00 RPM | 58 .26 RPM |
SRP017611_liver | 0 .00 RPM | 23 .79 RPM |
SRP030211_testis | 0 .00 RPM | 38 .40 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000021491 | 10 retrocopies |
retro_btau_445, retro_btau_769 , retro_btau_770, retro_btau_772, retro_btau_773, retro_btau_774, retro_btau_803, retro_btau_804, retro_btau_805, retro_btau_806,
|
Canis familiaris | ENSCAFG00000010508 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015786 | 1 retrocopy |