RetrogeneDB ID: | retro_cfam_596 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 14:19730178..19730385(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLR2F | ||
Ensembl ID: | ENSCAFG00000001437 | ||
Aliases: | None | ||
Description: | polymerase (RNA) II (DNA directed) polypeptide F [Source:HGNC Symbol;Acc:9193] |
Percent Identity: | 65.75 % |
Parental protein coverage: | 57.48 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | PYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELI |
PYM..Y.....LGT.ALQIAMC.PVMVELEG..DPLLI.MK.LK..KIP..I..YLPD.SYED..VD..I | |
Retrocopy | PYMGIY----MLGT*ALQIAMCTPVMVELEGDSDPLLITMKKLKVQKIPVTICHYLPDESYEDCRVDKVI |
Parental | ITD |
IT. | |
Retrocopy | ITN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 30 .87 RPM |
SRP017611_brain | 0 .00 RPM | 8 .81 RPM |
SRP017611_kidney | 0 .00 RPM | 63 .53 RPM |
SRP017611_liver | 0 .00 RPM | 9 .64 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010331 | 1 retrocopy | |
Bos taurus | ENSBTAG00000004820 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000001437 | 1 retrocopy |
retro_cfam_596 ,
|
Myotis lucifugus | ENSMLUG00000014315 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019063 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000012997 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000025463 | 1 retrocopy |