RetrogeneDB ID: | retro_chof_2152 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_53579:9177..9383(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL12 | ||
Ensembl ID: | ENSCHOG00000006732 | ||
Aliases: | None | ||
Description: | ribosomal protein L12 [Source:HGNC Symbol;Acc:10302] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 61.06 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | YLRC-TGGEVGATSALAPKIGPLGLSPKK-VGDDIAKATGDWK-GLRITVKLTIQNRQAQIEVVPSASAL |
.LRC.TGGEV.A.SAL.PKI..LGLSPK..VGDDI.KATGDWK.G.RI.VK....NR..Q.E.V...SAL | |
Retrocopy | HLRC>TGGEVHAMSALVPKIRFLGLSPKQ<VGDDITKATGDWK<GSRIIVKPAHSNR*TQFEMVSFCSAL |
Parental | II |
II | |
Retrocopy | II |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000006732 | 32 retrocopies |
retro_chof_1081, retro_chof_129, retro_chof_145, retro_chof_1469, retro_chof_147, retro_chof_1531, retro_chof_156, retro_chof_1666, retro_chof_1724, retro_chof_1843, retro_chof_1886, retro_chof_197, retro_chof_1992, retro_chof_2080, retro_chof_2152 , retro_chof_2169, retro_chof_2279, retro_chof_2318, retro_chof_249, retro_chof_2599, retro_chof_2614, retro_chof_2656, retro_chof_295, retro_chof_310, retro_chof_354, retro_chof_386, retro_chof_484, retro_chof_592, retro_chof_677, retro_chof_831, retro_chof_916, retro_chof_925,
|
Latimeria chalumnae | ENSLACG00000015373 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000017669 | 10 retrocopies | |
Macropus eugenii | ENSMEUG00000007380 | 12 retrocopies | |
Monodelphis domestica | ENSMODG00000004571 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000016220 | 4 retrocopies |