RetrogeneDB ID: | retro_chof_403 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_104342:3625..3863(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRGN | ||
Ensembl ID: | ENSCHOG00000000448 | ||
Aliases: | None | ||
Description: | serglycin [Source:HGNC Symbol;Acc:9361] |
Percent Identity: | 72.5 % |
Parental protein coverage: | 51.63 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ALSILIGESSVQGYPMRRARYQWVRCSPDSNSANCIEEKGPVFNLPPGESNRLLPPRTDSLPMKSLLNVQ |
.L..LI.ESSVQGYPM..ARYQWV.CSPDSNSANC.EEKG.VF.LPPGESN..LP.RTD.L.M...LN.. | |
Retrocopy | SLLLLIWESSVQGYPMQTARYQWVSCSPDSNSANCVEEKGQVFSLPPGESNSSLPTRTDPLSMTRFLNMH |
Parental | EV-FPLSEDY |
.V.FPLSEDY | |
Retrocopy | DV>FPLSEDY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017969 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000448 | 9 retrocopies |
retro_chof_1085, retro_chof_1907, retro_chof_1936, retro_chof_1950, retro_chof_227, retro_chof_2572, retro_chof_403 , retro_chof_876, retro_chof_935,
|
Dasypus novemcinctus | ENSDNOG00000006889 | 2 retrocopies |