RetrogeneDB ID: | retro_cjac_1771 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:35158338..35158625(+) | ||
| Located in intron of: | ENSCJAG00000006466 | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000006472 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COPZ1 | ||
| Ensembl ID: | ENSCJAG00000018887 | ||
| Aliases: | None | ||
| Description: | coatomer protein complex, subunit zeta 1 [Source:HGNC Symbol;Acc:2243] |
| Percent Identity: | 89.69 % |
| Parental protein coverage: | 54.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGG-VILESDPQQVVHRVALRG |
| ..YENELMLMAVLNCLFDSL.Q.LRKNVEKRALLENMEGLFLAV.E.VDGG.VILESDPQQVVH.VALRG | |
| Retrocopy | AAYENELMLMAVLNCLFDSLRQILRKNVEKRALLENMEGLFLAVNETVDGG<VILESDPQQVVHPVALRG |
| Parental | EDVPLTEQTVSQVLQSAKEQIKWSLLR |
| EDVPLTEQT.SQVLQSAKEQIKWSLL. | |
| Retrocopy | EDVPLTEQTMSQVLQSAKEQIKWSLLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .16 RPM | 22 .54 RPM |
| SRP051959_heart | 0 .04 RPM | 17 .42 RPM |
| SRP051959_kidney | 0 .02 RPM | 28 .60 RPM |
| SRP051959_liver | 0 .00 RPM | 25 .95 RPM |
| SRP051959_lung | 0 .03 RPM | 20 .63 RPM |
| SRP051959_lymph_node | 0 .14 RPM | 24 .45 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 18 .72 RPM |
| SRP051959_spleen | 0 .17 RPM | 20 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005384 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000006536 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018887 | 2 retrocopies |
retro_cjac_1771 , retro_cjac_3951,
|
| Echinops telfairi | ENSETEG00000013499 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000008401 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000060992 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013364 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000036835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008730 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001654 | 2 retrocopies |