RetrogeneDB ID: | retro_cpor_1045 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_40:17888536..17888804(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA2 | ||
Ensembl ID: | ENSCPOG00000009178 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 [Source:UniProtKB/TrEMBL;Acc:H0VE12] |
Percent Identity: | 52.69 % |
Parental protein coverage: | 92.93 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAAAAASRVVGAKLGL-REIRIHLCQRSPGSQGVRDFIQKRYVELKKANPDLPILIRECSDVQPKLWARY |
M....ASR...A.LG..R..R..L....P...G.RDFI.K..VELKKAN..L..LI..CS.VQ.K..A.. | |
Retrocopy | MVLIMASRASQAELGI>RKFRLTLM---PALEGIRDFIKKC*VELKKANLGLINLIHKCSVVQLKPLAH* |
Parental | AFGQEKNVSLNNFSADQVTRALE |
AF.Q.KNVSL..FSADQV.R.L. | |
Retrocopy | AFRQGKNVSLSHFSADQVIRGLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 15 .53 RPM |
SRP017611_kidney | 0 .00 RPM | 34 .86 RPM |
SRP017611_liver | 0 .00 RPM | 29 .47 RPM |
SRP040447_lung | 0 .03 RPM | 19 .92 RPM |
SRP040447_skeletal_muscle | 0 .03 RPM | 49 .45 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015041 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000005861 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016525 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009178 | 2 retrocopies |
retro_cpor_1045 , retro_cpor_1290,
|
Latimeria chalumnae | ENSLACG00000005796 | 1 retrocopy | |
Mus musculus | ENSMUSG00000014294 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009325 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000027727 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015860 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017571 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000014371 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005978 | 1 retrocopy |