RetrogeneDB ID: | retro_cpor_199 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_10:15126547..15126725(+) | ||
Located in intron of: | ENSCPOG00000007287 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMA7 | ||
Ensembl ID: | ENSCPOG00000027460 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.23 % |
Parental protein coverage: | 98.46 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSGREGGKKKPLKQPKKQAKEMDEEDRAFKQKQKEEQKKLEELKTKAAGK-GPLAATGGIKKSGK |
MS..E.G.KKPLKQPKKQAK..DEE.RAFKQKQ..EQK.LE....K..GK.GPLA.TGGIKK..K | |
Retrocopy | MSSLESG-KKPLKQPKKQAK*IDEEGRAFKQKQRVEQKRLE---NKG*GK>GPLA-TGGIKKLAK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .12 RPM | 13 .23 RPM |
SRP017611_kidney | 0 .10 RPM | 24 .18 RPM |
SRP017611_liver | 0 .00 RPM | 18 .67 RPM |
SRP040447_lung | 0 .28 RPM | 15 .56 RPM |
SRP040447_skeletal_muscle | 0 .04 RPM | 9 .89 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000027460 | 4 retrocopies |