RetrogeneDB ID: | retro_cpor_353 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_13:36298181..36298587(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRDX4 | ||
| Ensembl ID: | ENSCPOG00000004185 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.8 % |
| Parental protein coverage: | 50.74 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | SKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFRAINTEVVACSVD |
| ..P.PYW.GTAVI.GEFKELKLT.YRGKYL....YPLDFTFVCPTE....GDR.EE.R.I.T.VV.CS.. | |
| Retrocopy | ANPSPYWGGTAVIHGEFKELKLTGYRGKYLXXXXYPLDFTFVCPTEMMTYGDRTEELRSIETKVVLCSGN |
| Parental | SQFTHLAWINTPRRQGGLGSIKIPLLSDLNHQISKDY-GVYLEDAGHTLRGLFII-DDKGILRQITLND |
| .Q...L............G....P..SDL.H.I......VY.E.A.HTL..L....DD.G.LR..T..D | |
| Retrocopy | PQSACLTRFDASETR-RTGAHNDPAVSDLGHWIPENW<DVYPEAADHTLKALCLL<DDRGLLRPRTQPD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .12 RPM | 9 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 27 .74 RPM |
| SRP017611_liver | 0 .00 RPM | 34 .60 RPM |
| SRP040447_lung | 0 .05 RPM | 29 .41 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 12 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006165 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000004185 | 1 retrocopy |
retro_cpor_353 ,
|
| Cavia porcellus | ENSCPOG00000014137 | 3 retrocopies | |
| Equus caballus | ENSECAG00000010085 | 1 retrocopy | |
| Homo sapiens | ENSG00000123131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026790 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004904 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021366 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000004454 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000602 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012368 | 1 retrocopy |