RetrogeneDB ID: | retro_cpor_829 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:27555305..27555484(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C10ORF32 | ||
| Ensembl ID: | ENSCPOG00000021622 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.66 % |
| Parental protein coverage: | 52.63 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | ELLGQAARNMVLQEDAILHSEDSL-RKMAIITTHLQYQQEAIQKNVEQSSDLQDQLKHLLK |
| .LL.QAA..M.L.ED..LHS..S..R.MA..TTHLQY.QE.IQ...E.SSDLQD.L.HLL. | |
| Retrocopy | QLLSQAA*SMIL*EDTVLHSKGSQ<REMATVTTHLQYKQEGIQMDTEWSSDLQD*LNHLLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .85 RPM |
| SRP017611_kidney | 0 .00 RPM | 4 .50 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .66 RPM |
| SRP040447_lung | 0 .00 RPM | 6 .51 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 13 .91 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000021622 | 1 retrocopy |
retro_cpor_829 ,
|
| Loxodonta africana | ENSLAFG00000020646 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000013119 | 3 retrocopies | |
| Procavia capensis | ENSPCAG00000000834 | 1 retrocopy |