RetrogeneDB ID: | retro_dnov_596 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_6673:129310..129622(+) | ||
| Located in intron of: | ENSDNOG00000010663 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36AL | ||
| Ensembl ID: | ENSDNOG00000015954 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L36a-like [Source:HGNC Symbol;Acc:10346] |
| Percent Identity: | 58.49 % |
| Parental protein coverage: | 98.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MVNVPKTRRTFCKKCGKHQPHKVTQ-YKKGKDSLYAQGKRRYDREQSGYGGQTRPIFREKAKTTKKIVLR |
| MVN...T..T.C.KCG.HQ.HKV...YKKGKD.LY.QG...YD..QSGY.GQT...F..K.KTT.KIVLR | |
| Retrocopy | MVNFANTHQTSCMKCG*HQLHKVAH<YKKGKDWLYVQGRQHYDMKQSGYSGQTKQVFWKKEKTTEKIVLR |
| Parental | LECVEPNCRSKR-MLAIKRCKHFELGGDKKRKGQVI |
| L.C.E.....KR.MLA.K..KH..L.G.KK.K.QVI | |
| Retrocopy | LKCAELKYKCKR>MLAVKKWKHSGLEGNKKTKAQVI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 133 .99 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 71 .35 RPM |
| SRP012922_heart | 0 .00 RPM | 65 .66 RPM |
| SRP012922_kidney | 0 .00 RPM | 149 .22 RPM |
| SRP012922_liver | 0 .00 RPM | 64 .09 RPM |
| SRP012922_lung | 0 .00 RPM | 157 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 81 .35 RPM |
| SRP012922_spleen | 0 .11 RPM | 200 .65 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000015954 | 23 retrocopies |
retro_dnov_1206, retro_dnov_1266, retro_dnov_1320, retro_dnov_1328, retro_dnov_1330, retro_dnov_1392, retro_dnov_1427, retro_dnov_1525, retro_dnov_1799, retro_dnov_1898, retro_dnov_227, retro_dnov_2302, retro_dnov_233, retro_dnov_2371, retro_dnov_243, retro_dnov_2488, retro_dnov_2503, retro_dnov_2587, retro_dnov_310, retro_dnov_596 , retro_dnov_699, retro_dnov_871, retro_dnov_936,
|
| Felis catus | ENSFCAG00000015397 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009460 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000025578 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001569 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011494 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000014178 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000012779 | 1 retrocopy |