RetrogeneDB ID: | retro_dnov_694 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_928:109255..109624(-) | ||
Located in intron of: | ENSDNOG00000003821 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VBP1 | ||
Ensembl ID: | ENSDNOG00000019432 | ||
Aliases: | None | ||
Description: | von Hippel-Lindau binding protein 1 [Source:HGNC Symbol;Acc:12662] |
Percent Identity: | 78.91 % |
Parental protein coverage: | 63.27 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | MAAGKDACVFGDVAAGNGRRLHLGI-EAVFVEDVDSFMKQPGNETADIVLKKLDEQYQKYKFMELNLA-Q |
MAAGKDA.VFG.VAAGNGR.LH..I..AVFVEDVDSFMK.PG.ETAD.VLKK.DEQ.QK.KF.EL.L... | |
Retrocopy | MAAGKDAGVFGEVAAGNGRQLHPRIPRAVFVEDVDSFMKHPGSETADTVLKKPDEQCQKCKFRELSLR<R |
Parental | KKRRLKGQIPEIKQTLEILKYMQKKKESTGSL-ETRFLLADNLYCKASV-PPTDKVCL |
K.R.LKGQIPEIKQTLEILKYMQK.KESTGSL.ETRF.LA.N.YCKASV.PPTD.VCL | |
Retrocopy | KRR-LKGQIPEIKQTLEILKYMQK*KESTGSL<ETRF*LAGNFYCKASV<PPTDQVCL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .39 RPM | 17 .11 RPM |
SRP012922_cerebellum | 0 .41 RPM | 13 .47 RPM |
SRP012922_heart | 0 .00 RPM | 14 .85 RPM |
SRP012922_kidney | 0 .27 RPM | 10 .13 RPM |
SRP012922_liver | 0 .15 RPM | 5 .88 RPM |
SRP012922_lung | 0 .31 RPM | 11 .30 RPM |
SRP012922_quadricep_muscle | 1 .04 RPM | 19 .04 RPM |
SRP012922_spleen | 0 .34 RPM | 16 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009058 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000019639 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000013652 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019432 | 1 retrocopy |
retro_dnov_694 ,
|
Dipodomys ordii | ENSDORG00000004628 | 2 retrocopies | |
Latimeria chalumnae | ENSLACG00000016144 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015095 | 1 retrocopy | |
Mus musculus | ENSMUSG00000031197 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000014475 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000017448 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000016566 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000002823 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012811 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006684 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000007833 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000002205 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000016258 | 1 retrocopy |