RetrogeneDB ID: | retro_dnov_801 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_109029:752..953(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CHP2 | ||
| Ensembl ID: | ENSDNOG00000005798 | ||
| Aliases: | None | ||
| Description: | calcineurin-like EF-hand protein 2 [Source:HGNC Symbol;Acc:24927] |
Retrocopy-Parental alignment summary:
>retro_dnov_801
CTCTACAGCCGGTTCACCAATCTGGACAAAGGAGAGAATGAGACTCTCAGCCAGGAAGATTTCCAGCAGATTCCAGAACT
TGCCTTCAATCCATTGGGGGACCGGATCATCACGGCCTTCTTTCCTAAGGGAGAGGACCAGGTAAACTTCCGTGGGTTCT
TGAGAACTTTGGCTCATTTCCAACCCATGGAGGATAATGAA
CTCTACAGCCGGTTCACCAATCTGGACAAAGGAGAGAATGAGACTCTCAGCCAGGAAGATTTCCAGCAGATTCCAGAACT
TGCCTTCAATCCATTGGGGGACCGGATCATCACGGCCTTCTTTCCTAAGGGAGAGGACCAGGTAAACTTCCGTGGGTTCT
TGAGAACTTTGGCTCATTTCCAACCCATGGAGGATAATGAA
ORF - retro_dnov_801 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 53.73 % |
| Parental protein coverage: | 64.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | LHHRFQALDRNKKGYLSRMDLQQIGALAVNPLGDRIIDSFFPDGSQRLDFPGFVRVLAHFRPVEDED |
| L..RF..LD......LS..D.QQI..LA.NPLGDRII..FFP.G.....F.GF.R.LAHF.P.ED.. | |
| Retrocopy | LYSRFTNLDKGENETLSQEDFQQIPELAFNPLGDRIITAFFPKGEDQVNFRGFLRTLAHFQPMEDNE |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 106 .18 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP012922_heart | 0 .00 RPM | 1 .39 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .15 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .04 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .00 RPM |
Dasypus novemcinctus was not studied using ChIP-Seq data.
Dasypus novemcinctus was not studied using EST data.
Dasypus novemcinctus was not studied using FANTOM5 data.
retro_dnov_801 was not experimentally validated.
Retrocopy orthology:
Dasypus novemcinctus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000005798 | 1 retrocopy |
retro_dnov_801 ,
|
| Macropus eugenii | ENSMEUG00000007291 | 1 retrocopy |