RetrogeneDB ID: | retro_dord_322 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
Coordinates: | scaffold_1161:97018..97256(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cdc42se1 | ||
Ensembl ID: | ENSDORG00000007370 | ||
Aliases: | None | ||
Description: | CDC42 small effector 1 [Source:MGI Symbol;Acc:MGI:1889510] |
Percent Identity: | 86.25 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTG-AVQEQMRSKGNR |
MSEFWHKLGCCVVE.PQ..KKRR.ID.TMIGEPMNFVH.THIGSGEMGAGDG..MTG.AVQEQM.SKGNR | |
Retrocopy | MSEFWHKLGCCVVEEPQLNKKRRQIDWTMIGEPMNFVHPTHIGSGEMGAGDGPTMTG>AVQEQMKSKGNR |
Parental | DRPWSNSRGL |
.RPWSNSRGL | |
Retrocopy | HRPWSNSRGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000015363 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000007370 | 1 retrocopy |
retro_dord_322 ,
|
Echinops telfairi | ENSETEG00000019984 | 1 retrocopy | |
Mus musculus | ENSMUSG00000046722 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007000 | 1 retrocopy |