RetrogeneDB ID: | retro_ecab_378 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 16:38151369..38151576(-) | ||
| Located in intron of: | ENSECAG00000019650 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS20 | ||
| Ensembl ID: | ENSECAG00000012463 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S20 [Source:HGNC Symbol;Acc:10405] |
| Percent Identity: | 69.57 % |
| Parental protein coverage: | 57.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTP |
| .AFKDTGK.P.EPEVAI...RITLTS..VKSLEK..ADLIR..KEKNLKVKGPV..PTKT......K.P | |
| Retrocopy | IAFKDTGKSPMEPEVAIQ*TRITLTSYKVKSLEKAYADLIRVVKEKNLKVKGPVQIPTKTREKLLVKVP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1033 .26 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 272 .96 RPM |
| SRP021940_embryo | 0 .00 RPM | 669 .95 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 345 .97 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 524 .77 RPM |
| SRP021940_testis | 0 .00 RPM | 485 .84 RPM |