RetrogeneDB ID: | retro_ecab_470 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 19:14204673..14205023(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ANAPC15 | ||
| Ensembl ID: | ENSECAG00000021041 | ||
| Aliases: | None | ||
| Description: | anaphase promoting complex subunit 15 [Source:HGNC Symbol;Acc:24531] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 99.17 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | MSTLFPSLFPRVTETLWFNLDRPCVEETEL-QQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED |
| MSTL.PSL.P.VTE.LWFNLD.PCVEE....QQ..Q..QA.L.S..EK.NNLV.I.KP.SEHYDD...E. | |
| Retrocopy | MSTLLPSLLPHVTEILWFNLDWPCVEERAA>QQEQQ--QA*L*STIEKNNNLVSIDKPVSEHYDDKKGEE |
| Parental | EDDD-EDSEEDSEDDEDM-QDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM |
| ......DS.EDSEDDED..QDMDE..DY.E.PDDGEV.EVDMEGN.QDQDQW. | |
| Retrocopy | DEGE<RDS-EDSEDDEDI<QDMDEISDYSE*PDDGEVIEVDMEGNKQDQDQWI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 10 .21 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 12 .57 RPM |
| SRP021940_embryo | 0 .00 RPM | 22 .22 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 9 .29 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 9 .72 RPM |
| SRP021940_testis | 0 .00 RPM | 69 .51 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1999 |
| Pongo abelii | retro_pabe_2388 |
| Bos taurus | retro_btau_269 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010843 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002999 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005781 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021041 | 1 retrocopy |
retro_ecab_470 ,
|
| Felis catus | ENSFCAG00000005321 | 1 retrocopy | |
| Homo sapiens | ENSG00000110200 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012501 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014120 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016270 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010260 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017234 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003646 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015797 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000004171 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014179 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010773 | 1 retrocopy |