RetrogeneDB ID: | retro_ecab_796 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 4:93875676..93875903(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MED10 | ||
Ensembl ID: | ENSECAG00000023738 | ||
Aliases: | None | ||
Description: | mediator complex subunit 10 [Source:HGNC Symbol;Acc:28760] |
Percent Identity: | 58.44 % |
Parental protein coverage: | 71.03 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | RELNFIVTGLQDIDKCRQQLHDITVPLEVFE-YIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKS |
..LN...TGLQD..K..QQL..IT.PLEVF..Y.D.G.N......ECL.R.LA..EQVKGKIDT.KKFKS | |
Retrocopy | QKLNCTATGLQDTNKYKQQLRNITLPLEVFS<YTDRG*NSKPCMVECLGRSLARSEQVKGKIDTIKKFKS |
Parental | LLIQELS |
L..Q.L. | |
Retrocopy | LFLQQLT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 3 .19 RPM |
SRP021940_cerebellum | 0 .00 RPM | 9 .61 RPM |
SRP021940_embryo | 0 .00 RPM | 8 .72 RPM |
SRP021940_placental_villous | 0 .00 RPM | 6 .59 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 7 .80 RPM |
SRP021940_testis | 0 .00 RPM | 13 .17 RPM |
Species | RetrogeneDB ID |
---|---|
Canis familiaris | retro_cfam_721 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006767 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000010346 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004579 | 1 retrocopy | |
Equus caballus | ENSECAG00000023738 | 1 retrocopy |
retro_ecab_796 ,
|
Echinops telfairi | ENSETEG00000000027 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000002025 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000005988 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015506 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000002763 | 1 retrocopy |