RetrogeneDB ID: | retro_etel_1744 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_291573:45447..45676(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NCMAP | ||
Ensembl ID: | ENSETEG00000006813 | ||
Aliases: | None | ||
Description: | noncompact myelin associated protein [Source:HGNC Symbol;Acc:29332] |
Percent Identity: | 86.08 % |
Parental protein coverage: | 75.49 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MTTVTPLGATTF-FSLNMTTRGEDFLYKSSGAIVAAIVVVVIVIFTVVLILLKMYNRKMRTRR-ELEPKG |
MTTVTPLG.TTF.FSLNMTTRGEDFLY.S.G.IV.AIVVVVIVIFTVVLILLKMYNRKM.TR..ELEPKG | |
Retrocopy | MTTVTPLGVTTF<FSLNMTTRGEDFLYESLGTIVTAIVVVVIVIFTVVLILLKMYNRKMGTRE<ELEPKG |
Parental | PKPASSSAL |
.KPAS.SAL | |
Retrocopy | LKPASPSAL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000012604 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006813 | 1 retrocopy |
retro_etel_1744 ,
|