RetrogeneDB ID: | retro_etel_357 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_5926:198742..198942(+) | ||
Located in intron of: | ENSETEG00000013536 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC2 | ||
Ensembl ID: | ENSETEG00000010422 | ||
Aliases: | None | ||
Description: | COX assembly mitochondrial protein 2 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:24447] |
Percent Identity: | 73.53 % |
Parental protein coverage: | 84.81 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | HPDLSPHLHTEECNTLINLLKECHRNHSVLKFFGHCNDLDREMRKCLKNEXXXXRTRSR-EHGDVMRK |
HPDLSPHL..EECNTLINLLKECH.NHS.L.FF.H.N.LD.EMRKCL.NE....RT.SR.EHG.V.RK | |
Retrocopy | HPDLSPHLQAEECNTLINLLKECHNNHSGLNFFDHRNELDLEMRKCLTNEYAERRTHSR<EHGPVTRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013929 | 2 retrocopies | |
Bos taurus | ENSBTAG00000017009 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010422 | 3 retrocopies |
retro_etel_2190, retro_etel_357 , retro_etel_816,
|
Felis catus | ENSFCAG00000004977 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000004378 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000011915 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025763 | 1 retrocopy | |
Sorex araneus | ENSSARG00000008906 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001006 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000038 | 3 retrocopies |