RetrogeneDB ID: | retro_fcat_1171 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C1:36141463..36141660(-) | ||
Located in intron of: | ENSFCAG00000024832 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NENF | ||
Ensembl ID: | ENSFCAG00000031796 | ||
Aliases: | None | ||
Description: | neudesin neurotrophic factor [Source:HGNC Symbol;Acc:30384] |
Percent Identity: | 58.21 % |
Parental protein coverage: | 51.97 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ITNRLLSSYAGREEDQPI-YMAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTH |
....LL....G.E.D.P...MA.KGVVF....G.E.YGRG.PYNALTGKD.TR.V..M.LDPADLT. | |
Retrocopy | LCTKLLLCCGGEEDDLPM<VMAMKGVVFLWNGGMECYGRGVPYNALTGKDFTRAVITMPLDPADLTY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 17 .45 RPM |
SRP017611_kidney | 0 .00 RPM | 47 .51 RPM |
SRP017611_liver | 0 .00 RPM | 6 .87 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001341 | 1 retrocopy | |
Bos taurus | ENSBTAG00000000759 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000003399 | 1 retrocopy | |
Felis catus | ENSFCAG00000031796 | 1 retrocopy |
retro_fcat_1171 ,
|
Homo sapiens | ENSG00000117691 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025197 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002142 | 2 retrocopies | |
Mus musculus | ENSMUSG00000037499 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002893 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000014204 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000236 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000001961 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000015597 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000022293 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000001880 | 3 retrocopies |