RetrogeneDB ID: | retro_fcat_222 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A1:34009717..34010077(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS18 | ||
Ensembl ID: | ENSFCAG00000004013 | ||
Aliases: | None | ||
Description: | ribosomal protein S18 [Source:HGNC Symbol;Acc:10401] |
Percent Identity: | 63.71 % |
Parental protein coverage: | 78.95 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | IKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNP-RQYKIPDWFLNRQKDVKDG-KYSQVLA |
.K.V..RY..VVLRK.D.D.TKRAGELT.DEVE.V..IMQNP......PDWFLNRQK.VKDG.KYS.VLA | |
Retrocopy | VKSVE*RYSPVVLRKTDSDITKRAGELTDDEVECVTAIMQNP>EGRRSPDWFLNRQKNVKDG>KYSHVLA |
Parental | NGLDNKLREDLERLKKIRAHRGLRHF-WGLRVRGQHT-KTTGRRGRTVGVSKKK |
N.L.NK...DLE.LKK..A...L.HF...L.V.G..T.KTTG..G.TVGVSKKK | |
Retrocopy | NSLYNKFCQDLEGLKKTQALKMLHHF<LKLHVGGWRT<KTTGHCGCTVGVSKKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 116 .49 RPM |
SRP017611_kidney | 0 .00 RPM | 336 .48 RPM |
SRP017611_liver | 0 .00 RPM | 218 .76 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000002918 | 1 retrocopy | |
Ailuropoda melanoleuca | ENSAMEG00000001623 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000019675 | 4 retrocopies | |
Felis catus | ENSFCAG00000004013 | 7 retrocopies |
retro_fcat_1058, retro_fcat_1536, retro_fcat_166, retro_fcat_222 , retro_fcat_313, retro_fcat_327, retro_fcat_430,
|
Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007360 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000002306 | 6 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002417 | 13 retrocopies |