RetrogeneDB ID: | retro_ggor_2013 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 4:3366465..3366690(+) | ||
Located in intron of: | ENSGGOG00000003385 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | XAGE3 | ||
Ensembl ID: | ENSGGOG00000027404 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72. % |
Parental protein coverage: | 67.57 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MIWRGRSTYRPRPRRSVPSPEQIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAEIQVPDLEADL |
M.W.GRS..R.RPRR....PE..GP.LEP.DE.PQQEEPP.ESR.P.PGQEREED.GAAEI.V.D.EADL | |
Retrocopy | MSWQGRSACRLRPRRYLQPPELTGPVLEPSDEQPQQEEPPPESRGPTPGQEREEDHGAAEILVLDQEADL |
Parental | QELSQ |
QELSQ | |
Retrocopy | QELSQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .19 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .16 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .12 RPM | 0 .00 RPM |
SRP007412_liver | 0 .05 RPM | 0 .03 RPM |
SRP007412_testis | 0 .21 RPM | 0 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1965 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gorilla gorilla | ENSGGOG00000027404 | 1 retrocopy |
retro_ggor_2013 ,
|
Pongo abelii | ENSPPYG00000020369 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021922 | 1 retrocopy |