RetrogeneDB ID: | retro_ggor_883 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:65641459..65641657(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000204136 | ||
Ensembl ID: | ENSGGOG00000009067 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.64 % |
Parental protein coverage: | 66. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MNVKGKVILSMLVVSTVIIVFWEFINSPEGSFLWMYHSKNPEVDDSSAQKGWWFLSWFNYGIHNYQ |
MNVKG.VI..MLVVST.I.V.W..IN..EGS.LWMYH.K.P.V.D...QKG.WF.S.FN.G.HN.Q | |
Retrocopy | MNVKGNVIPPMLVVSTAIVVVWKCINTQEGSLLWMYHLKHP*VVDGGGQKGRWFPSCFNNGTHNPQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 0 .34 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .16 RPM |
SRP007412_heart | 0 .00 RPM | 0 .41 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .12 RPM |
SRP007412_liver | 0 .00 RPM | 0 .05 RPM |
SRP007412_testis | 0 .10 RPM | 0 .41 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_936 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012094 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000009067 | 1 retrocopy |
retro_ggor_883 ,
|
Pongo abelii | ENSPPYG00000019565 | 1 retrocopy |