RetrogeneDB ID: | retro_itri_1152 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393388.1:2836010..2836247(+) | ||
| Located in intron of: | ENSSTOG00000010265 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SH3BGRL | ||
| Ensembl ID: | ENSSTOG00000013216 | ||
| Aliases: | None | ||
| Description: | SH3 domain binding glutamic acid-rich protein like [Source:HGNC Symbol;Acc:10823] |
| Percent Identity: | 64.56 % |
| Parental protein coverage: | 69.3 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | EKDIAANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKE |
| .K.I.......K.MREN.PENS.PATG..LPPQIFN.SQ..G..D.F.EA.E.N.VYAFLGL.APPG.KE | |
| Retrocopy | QKKIL*PVKSQKRMRENAPENSGPATGSSLPPQIFNDSQNCGG*DDFLEAQEKNTVYAFLGLMAPPGLKE |
| Parental | AEAQAKQQA |
| AE.QA.QQA | |
| Retrocopy | AEGQAQQQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004130 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003568 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012267 | 3 retrocopies | |
| Equus caballus | ENSECAG00000012612 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013216 | 1 retrocopy |
retro_itri_1152 ,
|