RetrogeneDB ID: | retro_itri_1458 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393493.1:133219..133449(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LRRFIP2 | ||
Ensembl ID: | ENSSTOG00000023775 | ||
Aliases: | None | ||
Description: | leucine rich repeat (in FLII) interacting protein 2 [Source:HGNC Symbol;Acc:6703] |
Percent Identity: | 59.49 % |
Parental protein coverage: | 54.93 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 1 |
Parental | LDEKSDKQYAENYTRPSSRNSASATT-PLSGNSSRRGSGDTSSLIDPDTSLSELRESLSEVEEKYKKAMV |
LDEK.DK..AEN.TRPSS.NSA.A....LSGNSSR.GSGDT.S.IDPDTSL.EL...L.....K.KK..V | |
Retrocopy | LDEKPDKL*AENDTRPSS*NSALAAN<SLSGNSSR*GSGDTNSFIDPDTSLTELP*CLKH-RKKSKKGIV |
Parental | SNAQLDNEK |
....L..E. | |
Retrocopy | FSEHLNQEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Macaca mulatta | ENSMMUG00000022539 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023775 | 1 retrocopy |
retro_itri_1458 ,
|