RetrogeneDB ID: | retro_mdom_482 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:715660047..715660293(+) | ||
| Located in intron of: | ENSMODG00000025777 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000023045 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_mdom_482
TGTGAGAGGATAGCTATTCTTCTGCAGGCAGTAATAGTGTCCGACGTCCTCTGGTTCCACACCGCTGATGGTAAGAGAGA
AATCTGTCCCAGAGCCACTGCCACTGAACCGGGCAGGGACCCCAGAGTGTAGGTTGGAGGCCCAGTAAATGAGGAGCCTG
GGAGACTTGCCTGGGGGATGTTGGTACCAGTCTAAGGCATTACCAATGCTCTGACTGGCCCTGCAGGACAGGGTGACCCT
CTCTCC
ORF - retro_mdom_482 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 76.83 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | CERPGPSLLTVIVPDVFWFHTADGKRVICPRATATEPGRDARLQVGSIVNEEPGRLAWGLLVPVYAGTNA |
| CER....L..VIV.DV.WFHTADGKR.ICPRATATEPGRD.R..VG..VNEEPGRLAWG.LVPV...TNA | |
| Retrocopy | CERIAILLQAVIVSDVLWFHTADGKREICPRATATEPGRDPRV*VGGPVNEEPGRLAWGMLVPV*GITNA |
| Parental | LTGPAGQGDRLS |
| LTGPAGQGD.LS | |
| Retrocopy | LTGPAGQGDPLS |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Monodelphis domestica was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mdom_482 retrocopy.
Monodelphis domestica was not studied using FANTOM5 data.
retro_mdom_482 was not experimentally validated.
Retrocopy orthology:
Monodelphis domestica does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 10 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000023045 | 10 retrocopies |
retro_mdom_471, retro_mdom_472, retro_mdom_474, retro_mdom_478, retro_mdom_480, retro_mdom_482 , retro_mdom_484, retro_mdom_486, retro_mdom_657, retro_mdom_658,
|