RetrogeneDB ID: | retro_mdom_559 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:302542716..302542926(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MYEOV2 | ||
Ensembl ID: | ENSMODG00000013501 | ||
Aliases: | None | ||
Description: | myeloma overexpressed 2 [Source:HGNC Symbol;Acc:21314] |
Percent Identity: | 63.01 % |
Parental protein coverage: | 68.87 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | TSVTCWAETEGQIDGIMKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDD |
TS....A..EGQ.D..MKPAV.E.FP...G.YVDL....G....L.DLAANEKA.HA.FFNDFE.LFDDD | |
Retrocopy | TSLKYQAKREGQTD*GMKPAVEETFPQDPGLYVDLE---GGRRPLIDLAANEKAFHAEFFNDFEELFDDD |
Parental | DIQ |
DIQ | |
Retrocopy | DIQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000172428 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011336 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000013501 | 1 retrocopy |
retro_mdom_559 ,
|
Mus musculus | ENSMUSG00000073616 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000776 | 1 retrocopy |