RetrogeneDB ID: | retro_mluc_2068 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL430012:788130..788350(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CHURC1 | ||
Ensembl ID: | ENSMLUG00000004300 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 77.33 % |
Parental protein coverage: | 66.07 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FMLITNKSLKEEDGEEIVTYDHLCQNC-HHVVARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPR |
FMLITNKSLKEEDGEEIVTYDHL.....H.V....E.TF.IMDEFQE.T.LCLLCGKAED..SILPDDPR | |
Retrocopy | FMLITNKSLKEEDGEEIVTYDHLLELS>HVVARHEE-TFHIMDEFQEHTALCLLCGKAEDINSILPDDPR |
Parental | QMTLL |
QMTL. | |
Retrocopy | QMTLI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Myotis lucifugus | ENSMLUG00000004300 | 1 retrocopy |
retro_mluc_2068 ,
|
Monodelphis domestica | ENSMODG00000009664 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006792 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001838 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011384 | 1 retrocopy |